| Edit |   |
| Antigenic Specificity | LRRC52 |
| Clone | polyclonal |
| Host Species | Rabbit |
| Reactive Species | human |
| Isotype | n/a |
| Format | immunogen affinity purified |
| Size | 100 ul |
| Concentration | n/a |
| Applications | Western Blot |
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
| Description | The LRRC52 Antibody from Novus Biologicals is a rabbit polyclonal antibody to LRRC52. This antibody reacts with human. The LRRC52 Antibody has been validated for the following applications: Western Blot. |
| Immunogen | Synthetic peptides corresponding to LRRC52(leucine rich repeat containing 52) Antibody(against the N terminal of LRRC52. Peptide sequence QEVICTGKQLTEYPLDIPLNTRRLFLNENRITSLPAMHLGLLSDLVYLDC. |
| Other Names | FLJ25811, leucine rich repeat containing 52, leucine-rich repeat-containing protein 52 |
| Gene, Accession # | LRRC52, Gene ID: 440699 |
| Catalog # | NBP1-70625 |
| Price | |
| Order / More Info | LRRC52 Antibody from NOVUS BIOLOGICALS, LLC |
| Product Specific References | n/a |