| Edit |   |
| Antigenic Specificity | LRRC56 |
| Clone | polyclonal |
| Host Species | Rabbit |
| Reactive Species | human |
| Isotype | n/a |
| Format | immunogen affinity purified |
| Size | 100 ul |
| Concentration | n/a |
| Applications | Western Blot |
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
| Description | The LRRC56 Antibody from Novus Biologicals is a rabbit polyclonal antibody to LRRC56. This antibody reacts with human. The LRRC56 Antibody has been validated for the following applications: Western Blot. |
| Immunogen | Synthetic peptides corresponding to LRRC56(leucine rich repeat containing 56) The peptide sequence was selected from the N terminal of LRRC56. Peptide sequence LEMCVDTREGSLGNFGVHLPNLDQLKLNGSHLGSLRDLGTSLGHLQVLWL. |
| Other Names | leucine rich repeat containing 56 |
| Gene, Accession # | LRRC56, Gene ID: 115399 |
| Catalog # | NBP1-70626 |
| Price | |
| Order / More Info | LRRC56 Antibody from NOVUS BIOLOGICALS, LLC |
| Product Specific References | n/a |