| Edit |   |
| Antigenic Specificity | LRRC57 |
| Clone | polyclonal |
| Host Species | Rabbit |
| Reactive Species | human |
| Isotype | n/a |
| Format | immunogen affinity purified |
| Size | 20ul |
| Concentration | n/a |
| Applications | Western Blot |
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
| Description | The LRRC57 Antibody from Novus Biologicals is a rabbit polyclonal antibody to LRRC57. This antibody reacts with human. The LRRC57 Antibody has been validated for the following applications: Western Blot. |
| Immunogen | Synthetic peptides corresponding to LRRC57(leucine rich repeat containing 57) The peptide sequence was selected from the N terminal of LRRC57. Peptide sequence MGNSALRAHVETAQKTGVFQLKDRGLTEFPADLQKLTSNLRTIDLSNNKI. |
| Other Names | DKFZp686H1865, FLJ36812, leucine rich repeat containing 57, leucine-rich repeat-containing protein 57 |
| Gene, Accession # | LRRC57, Gene ID: 255252, Accession: Q8N9N7, SwissProt: Q8N9N7 |
| Catalog # | NBP1-56321-20ul |
| Price | |
| Order / More Info | LRRC57 Antibody from NOVUS BIOLOGICALS, LLC |
| Product Specific References | n/a |