| Edit |   |
|---|
| Antigenic Specificity | SYCP3 - N-terminal region |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | affinity purified |
|---|
| Size | 50ug |
|---|
| Concentration | n/a |
|---|
| Applications | IHC,WB |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | Rabbit Polyclonal Anti-SYCP3 Antibody - N-terminal region |
|---|
| Immunogen | The immunogen for anti-SYCP3 antibody: synthetic peptide directed towards the N terminal of human SYCP3. Synthetic peptide located within the following region: VSSGKKYSRKSGKPSVEDQFTRAYDFETEDKKDLSGSEEDVIEGKTAVIE |
|---|
| Other Names | COR1, SCP3, SPGF4, synaptonemal complex protein 3 |
|---|
| Gene, Accession # | SYCP3, Accession: NM_153694 |
|---|
| Catalog # | TA344376 |
|---|
| Price | |
|---|
| Order / More Info | SYCP3 - N-terminal region Antibody from ORIGENE TECHNOLOGIES |
|---|
| Product Specific References | n/a |
|---|