| Edit |   |
| Antigenic Specificity | GEFT |
| Clone | polyclonal |
| Host Species | Rabbit |
| Reactive Species | human |
| Isotype | n/a |
| Format | immunogen affinity purified |
| Size | 0.1 ml |
| Concentration | n/a |
| Applications | Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin. For IHC-Paraffin, HIER pH 6 retrieval is recommended. |
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
| Description | The GEFT Antibody from Novus Biologicals is a rabbit polyclonal antibody to GEFT. This antibody reacts with human. The GEFT Antibody has been validated for the following applications: Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin. Specificity of human GEFT antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
| Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids: HSKHCLSVETEADSGQAGPYENWMLEPALATGEELPELTLLTTLLEGPGD KTQPPEEETLSQAPESEEEQKKKALERSMYV |
| Other Names | GEFTRAC/CDC42 exchange factor, Guanine nucleotide exchange factor GEFT, p63RhoGEFrho guanine nucleotide exchange factor 25, Rac/Cdc42/Rho exchange factor GEFT, Rho guanine nucleotide exchange factor (GEF) 25, RhoA/RAC/CDC42 exchange factor, RhoA/Rac/Cdc42 guanine nucleotide exchange factor GEFT |
| Gene, Accession # | ARHGEF25, Gene ID: 115557 |
| Catalog # | NBP2-14309 |
| Price | |
| Order / More Info | GEFT Antibody from NOVUS BIOLOGICALS, LLC |
| Product Specific References | n/a |