| Edit |   |
|---|
| Antigenic Specificity | TBL3 |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | immunogen affinity purified |
|---|
| Size | 20ul |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blot |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The TBL3 Antibody from Novus Biologicals is a rabbit polyclonal antibody to TBL3. This antibody reacts with human. The TBL3 Antibody has been validated for the following applications: Western Blot. |
|---|
| Immunogen | Synthetic peptides corresponding to TBL3(transducin (beta)-like 3) The peptide sequence was selected from the N terminal of TBL3. Peptide sequence MAETAAGVGRFKTNYAVERKIEPFYKGGKAQLDQTGQHLFCVCGTRVNIL. |
|---|
| Other Names | SAZDWD repeat-containing protein SAZD, transducin (beta)-like 3, transducin beta-like protein 3, WD-repeat protein SAZD |
|---|
| Gene, Accession # | TBL3, Gene ID: 10607, Accession: Q12788, SwissProt: Q12788 |
|---|
| Catalog # | NBP1-58934-20ul |
|---|
| Price | |
|---|
| Order / More Info | TBL3 Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|