| 产品详情 |
| Edit |   |
| Antigenic Specificity | BPHL |
| Clone | polyclonal |
| Host Species | Rabbit |
| Reactive Species | human |
| Isotype | n/a |
| Format | immunogen affinity purified |
| Size | 0.1 ml |
| Concentration | n/a |
| Applications | Western Blot, Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin. For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100. |
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
| Description | The BPHL Antibody from Novus Biologicals is a rabbit polyclonal antibody to BPHL. This antibody reacts with human. The BPHL Antibody has been validated for the following applications: Western Blot, Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin. Specificity of human BPHL antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
| Immunogen | This antibody was developed against a recombinant protein corresponding to amino acids: RTRKPLEALYGYDYFARTCEKWVDGIRQFKHLPDGNICRHLLPRVQCPALIVHGEKDPLVPRFHADFIHKHVKGSRLHLMPEG |
| Other Names | biphenyl hydrolase-like (serine hydrolase), Biphenyl hydrolase-like protein, Biphenyl hydrolase-related protein, Bph-rp, Breast epithelial mucin-associated antigen, EC 3.1, MCNAA, MGC125930, MGC41865, VACVASE, valacyclovir hydrolase, valacyclovirase |
| Gene, Accession # | BPHL, Gene ID: 670, Accession: Q86WA6, SwissProt: Q86WA6 |
| Catalog # | NBP2-38328 |
| Price | |
| Order / More Info | BPHL Antibody from NOVUS BIOLOGICALS, LLC |
| Product Specific References | n/a |
| 产品资料 |
|
|