| Edit |   |
| Antigenic Specificity | Metaxin 1 |
| Clone | polyclonal |
| Host Species | Rabbit |
| Reactive Species | human |
| Isotype | n/a |
| Format | immunogen affinity purified |
| Size | 100 ul |
| Concentration | n/a |
| Applications | Western Blot |
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
| Description | The Metaxin 1 Antibody from Novus Biologicals is a rabbit polyclonal antibody to Metaxin 1. This antibody reacts with human. The Metaxin 1 Antibody has been validated for the following applications: Western Blot. |
| Immunogen | Synthetic peptides corresponding to MTX1(metaxin 1) The peptide sequence was selected from the C terminal of MTX1. Peptide sequence CLTLLSQRLGSQKFFFGDAPASLDAFVFSYLALLLQAKLPSGKLQVHLRG. |
| Other Names | metaxin 1, metaxin-1, MTX, MTXNMitochondrial outer membrane import complex protein 1 |
| Gene, Accession # | MTX1, Gene ID: 4580, Accession: Q13505, SwissProt: Q13505 |
| Catalog # | NBP1-59449 |
| Price | |
| Order / More Info | Metaxin 1 Antibody from NOVUS BIOLOGICALS, LLC |
| Product Specific References | n/a |