| Edit |   |
|---|
| Antigenic Specificity | GADD45 alpha |
|---|
| Clone | 3D12 |
|---|
| Host Species | Mouse |
|---|
| Reactive Species | human |
|---|
| Isotype | IgG1 kappa |
|---|
| Format | IgG purified, no preservative |
|---|
| Size | 0.1 mg |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blot, ELISA, Proximity Ligation Assay. Antibody reactivity against Recombinant Protein with GST tag on ELISA and WB. GST tag alone is used as a negative control. |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The GADD45 alpha Antibody (3D12) from Novus Biologicals is a mouse monoclonal antibody to GADD45 alpha. This antibody reacts with human. The GADD45 alpha Antibody (3D12) has been validated for the following applications: Western Blot, ELISA, Proximity Ligation Assay. |
|---|
| Immunogen | GADD45A (AAH11757 76 a.a. - 165 a.a.) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. TLIQAFCCENDINILRVSNPGRLAELLLLETDAGPAASEGAEQPPDLHCVLVTNPHSSQWKDPALSQLICFCRESRYMDQWVPVINLPER |
|---|
| Other Names | DDIT-1, DDIT1growth arrest and DNA damage-inducible protein GADD45 alpha, DNA damage-inducible transcript 1 protein, DNA damage-inducible transcript-1, GADD45DNA-damage-inducible transcript 1, growth arrest and DNA-damage-inducible 45 alpha, growth arrest and DNA-damage-inducible, alpha |
|---|
| Gene, Accession # | GADD45A, Gene ID: 1647, Accession: AAH11757, SwissProt: AAH11757 |
|---|
| Catalog # | H00001647-M01 |
|---|
| Price | |
|---|
| Order / More Info | GADD45 alpha Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | PubMed: 18472964, 21368854 |
|---|