| 产品详情 |
| Edit |   |
| Antigenic Specificity | GADD153/CHOP |
| Clone | polyclonal |
| Host Species | Rabbit |
| Reactive Species | human |
| Isotype | n/a |
| Format | affinity purified |
| Size | 100 ul |
| Concentration | n/a |
| Applications | Immunocytochemistry/Immunofluorescence. ICC/IF Fixation Permeabilization: Use PFA/Triton X-100. |
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
| Description | The GADD153/CHOP Antibody from Novus Biologicals is a rabbit polyclonal antibody to GADD153/CHOP. This antibody reacts with human. The GADD153/CHOP Antibody has been validated for the following applications: Immunocytochemistry/Immunofluorescence. Specificity of human GADD153/CHOP antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
| Immunogen | This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: AESLPFSFGTLSSWELEAWYEDLQEVLSSDENGGTYVSPPGNEEEESKIFTTLDPASLAWLTEEEPEPAEVTSTSQ |
| Other Names | C/EBP-homologous protein, C/EBP-homologous protein 10, CCAAT/enhancer-binding protein homologous protein, CHOP-10, CHOP10 CEBPZ, CHOPC/EBP zeta, DDIT-3, DNA damage-inducible transcript 3 protein, DNA-damage-inducible transcript 3, GADD153, Growth arrest and DNA damage-inducible protein GADD153 |
| Gene, Accession # | DDIT3, Gene ID: 1649 |
| Catalog # | NBP2-58505 |
| Price | |
| Order / More Info | GADD153/CHOP Antibody from NOVUS BIOLOGICALS, LLC |
| Product Specific References | n/a |
| 产品资料 |
|
|