| Edit |   |
| Antigenic Specificity | FAM211B |
| Clone | polyclonal |
| Host Species | Rabbit |
| Reactive Species | human |
| Isotype | n/a |
| Format | immunogen affinity purified |
| Size | 20ul |
| Concentration | n/a |
| Applications | Western Blot |
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
| Description | The FAM211B Antibody from Novus Biologicals is a rabbit polyclonal antibody to FAM211B. This antibody reacts with human. The FAM211B Antibody has been validated for the following applications: Western Blot. |
| Immunogen | Synthetic peptide directed towards the middle region of human C22orf36. Peptide sequence WKSSDKICRQLIYHLTPHSKQQQGSSLRQRKTQSCLKSSLQKTLLAGETV. |
| Other Names | C22orf36, chromosome 22 open reading frame 36, family with sequence similarity 211, member B |
| Gene, Accession # | FAM211B, Gene ID: 388886, Accession: NP_997527, SwissProt: NP_997527 |
| Catalog # | NBP1-91473-20ul |
| Price | |
| Order / More Info | FAM211B Antibody from NOVUS BIOLOGICALS, LLC |
| Product Specific References | n/a |