| Edit |   |
| Antigenic Specificity | FAM212B |
| Clone | polyclonal |
| Host Species | Rabbit |
| Reactive Species | rat |
| Isotype | n/a |
| Format | immunogen affinity purified |
| Size | 20ul |
| Concentration | n/a |
| Applications | Western Blot |
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
| Description | The FAM212B Antibody from Novus Biologicals is a rabbit polyclonal antibody to FAM212B. This antibody reacts with rat. The FAM212B Antibody has been validated for the following applications: Western Blot. |
| Immunogen | The immunogen for this antibody is Fam212b middle region. Peptide sequence DNVFADLVGNWLDLPELEKGGERGETGGSGEPKGEKGQSRELGRKFALTA. |
| Other Names | C1orf183, family with sequence similarity 212, member B |
| Gene, Accession # | FAM212B, Gene ID: 55924, Accession: NP_001101183 |
| Catalog # | NBP1-98266-20ul |
| Price | |
| Order / More Info | FAM212B Antibody from NOVUS BIOLOGICALS, LLC |
| Product Specific References | n/a |