| Edit |   |
|---|
| Antigenic Specificity | FAM214B |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | immunogen affinity purified |
|---|
| Size | 0.1 ml |
|---|
| Concentration | n/a |
|---|
| Applications | Immunohistochemistry, Immunohistochemistry-Paraffin. For IHC-Paraffin, HIER pH 6 retrieval is recommended. |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The FAM214B Antibody from Novus Biologicals is a rabbit polyclonal antibody to FAM214B. This antibody reacts with human. The FAM214B Antibody has been validated for the following applications: Immunohistochemistry, Immunohistochemistry-Paraffin. Specificity of human FAM214B antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
|---|
| Immunogen | This antibody was developed against a recombinant protein corresponding to amino acids: CPTKRRLLPAGEAPDVSSEEEGPAPRRRRGSLGHPTAANSSDAKATPFWSHLLPGPKEPVLDPTDCGPMGRRLKGARR |
|---|
| Other Names | bA182N22.6, FLJ11560, hypothetical protein LOC80256, KIAA1539, P1.11659_5, RP11-182N22.6 |
|---|
| Gene, Accession # | FAM214B, Gene ID: 80256, Accession: Q7L5A3, SwissProt: Q7L5A3 |
|---|
| Catalog # | NBP2-38767 |
|---|
| Price | |
|---|
| Order / More Info | FAM214B Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|