| Edit |   |
|---|
| Antigenic Specificity | FAM216B |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | immunogen affinity purified |
|---|
| Size | 100 ul |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blot |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The FAM216B Antibody from Novus Biologicals is a rabbit polyclonal antibody to FAM216B. This antibody reacts with human. The FAM216B Antibody has been validated for the following applications: Western Blot. |
|---|
| Immunogen | Synthetic peptides corresponding to FAM216B The peptide sequence was selected from the N terminal of FAM216B 50ug). Peptide sequence MGQNWKRQQKLWNVPQLPFIRVPPSIYDTSLLKALNQGQQRYFYSIMRIY. |
|---|
| Other Names | C13orf30, chromosome 13 open reading frame 30, FLJ40919, hypothetical protein LOC144809, MGC138442 |
|---|
| Gene, Accession # | FAM216B, Gene ID: 144809, Accession: Q8N7L0, SwissProt: Q8N7L0 |
|---|
| Catalog # | NBP1-57767 |
|---|
| Price | |
|---|
| Order / More Info | FAM216B Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|