| 产品详情 |
| Edit |   |
|---|
| Antigenic Specificity | PAC1R |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | Protein A purified |
|---|
| Size | 100 ul |
|---|
| Concentration | n/a |
|---|
| Applications | Immunocytochemistry/Immunofluorescence. Recommended conditions: Fixation/Permeabilization: PFA/Triton X-100 |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The PAC1R Antibody from Novus Biologicals is a rabbit polyclonal antibody to PAC1R. This antibody reacts with human. The PAC1R Antibody has been validated for the following applications: Immunocytochemistry/Immunofluorescence. Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
|---|
| Immunogen | This antibody was developed against a recombinant protein corresponding to amino acids: KKEQAMCLEKIQRANELMGFNDSSPGCPGMWDNITCWKPAHVGEMVLVSCPELFRSFNPDQ |
|---|
| Other Names | adenylate cyclase activating polypeptide 1 (pituitary) receptor type 1, adenylate cyclase activating polypeptide 1 (pituitary) receptor type I, PACAP type I receptor, PACAP-R1, PACAP-R-1, PACAPRI, PACAPRPAC1, pituitary adenylate cyclase activating polypeptide 1 receptor type I Hiphop, pituitary adenylate cyclase-activating polypeptide type I receptor |
|---|
| Gene, Accession # | ADCYAP1R1, Gene ID: 117 |
|---|
| Catalog # | NBP2-68620 |
|---|
| Price | |
|---|
| Order / More Info | PAC1R Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|
| 产品资料 |
|
|