| 产品详情 |
| Edit |   |
|---|
| Antigenic Specificity | PACRG |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | affinity purified |
|---|
| Size | 100 ul |
|---|
| Concentration | n/a |
|---|
| Applications | Immunohistochemistry, Immunohistochemistry-Paraffin. For IHC-Paraffin, HIER pH 6 retrieval is recommended. |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The PACRG Antibody from Novus Biologicals is a rabbit polyclonal antibody to PACRG. This antibody reacts with human. The PACRG Antibody has been validated for the following applications: Immunohistochemistry, Immunohistochemistry-Paraffin. Specificity of human PACRG antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
|---|
| Immunogen | This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: AFKERPTKPTAFRKFYERGDFPIALEHDSKGNKIAWKVEIEKLDYHHYLPLF |
|---|
| Other Names | FLJ32724, Glup, HAK005771, Molecular chaperone/chaperonin-binding protein, PARK2 co-regulated, PARK2 coregulated gene protein, PARK2CRG, parkin coregulated gene protein, parkin co-regulated gene protein, RP3-495O10.2 |
|---|
| Gene, Accession # | PACRG, Gene ID: 135138 |
|---|
| Catalog # | NBP2-55838 |
|---|
| Price | |
|---|
| Order / More Info | PACRG Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|
| 产品资料 |
|
|