| Edit |   |
|---|
| Antigenic Specificity | PACSIN1 |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | immunogen affinity purified |
|---|
| Size | 25ul |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin. For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF Fixation Permeabilization: Use PFA/Triton X-100. |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The PACSIN1 Antibody from Novus Biologicals is a rabbit polyclonal antibody to PACSIN1. This antibody reacts with human. The PACSIN1 Antibody has been validated for the following applications: Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin. |
|---|
| Immunogen | This antibody was developed against a recombinant protein corresponding to amino acids: EKQPKKAEGVALTNATGAVESTSQAGDRGSVSSYDRGQPYATEWSDDESGN |
|---|
| Other Names | KIAA1379SDPI, protein kinase C and casein kinase substrate in neurons 1, protein kinase C and casein kinase substrate in neurons protein 1, syndapin I |
|---|
| Gene, Accession # | PACSIN1, Gene ID: 29993, Accession: Q9BY11, SwissProt: Q9BY11 |
|---|
| Catalog # | NBP2-33756-25ul |
|---|
| Price | |
|---|
| Order / More Info | PACSIN1 Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|