| Edit |   |
| Antigenic Specificity | PPAPDC2 |
| Clone | polyclonal |
| Host Species | Rabbit |
| Reactive Species | human |
| Isotype | n/a |
| Format | affinity purified |
| Size | 50ug |
| Concentration | n/a |
| Applications | WB |
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
| Description | Rabbit Polyclonal Anti-PPAPDC2 Antibody |
| Immunogen | The immunogen for Anti-PPAPDC2 Antibody: synthetic peptide directed towards the N terminal of human PPAPDC2. Synthetic peptide located within the following region: FPLAAAGPSQSPAPPLPEEDRMDLNPSFLGIALRSLLAIDLWLSKKLGVC |
| Other Names | PDP1, PSDP, bA6J24.6, phosphatidic acid phosphatase type 2 domain containing 2 |
| Gene, Accession # | PPAC2, Accession: NM_203453 |
| Catalog # | TA333317 |
| Price | |
| Order / More Info | PPAPDC2 Antibody from ORIGENE TECHNOLOGIES |
| Product Specific References | n/a |