| 产品详情 |
| Edit |   |
|---|
| Antigenic Specificity | SUV420H2 |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | immunogen affinity purified |
|---|
| Size | 0.1 ml |
|---|
| Concentration | n/a |
|---|
| Applications | Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin. For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF Fixation Permeabilization: Use PFA/Triton X-100. |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The SUV420H2 Antibody from Novus Biologicals is a rabbit polyclonal antibody to SUV420H2. This antibody reacts with human. The SUV420H2 Antibody has been validated for the following applications: Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin. Specificity of human SUV420H2 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
|---|
| Immunogen | This antibody was developed against a recombinant protein corresponding to amino acids: EGFFGEKNEHCECHTCERKGEGAFRTRPREPALPPRPLDKYQLRETKRRLQQGLDSG |
|---|
| Other Names | EC 2.1.1.43, FLJ98627, histone-lysine N-methyltransferase SUV420H2, KMT5Csuv4-20h2, Lysine N-methyltransferase 5C, MGC2705, Su(var)4-20 homolog 2, Suppressor of variegation 4-20 homolog 2, suppressor of variegation 4-20 homolog 2 (Drosophila), Suv4-20h2 |
|---|
| Gene, Accession # | SUV420H2, Gene ID: 84787, Accession: Q86Y97, SwissProt: Q86Y97 |
|---|
| Catalog # | NBP2-30524 |
|---|
| Price | |
|---|
| Order / More Info | SUV420H2 Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|
| 产品资料 |
|
|