| Edit |   |
|---|
| Antigenic Specificity | COMMD2 |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | rat |
|---|
| Isotype | n/a |
|---|
| Format | immunogen affinity purified |
|---|
| Size | 20ul |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blot |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The COMMD2 Antibody from Novus Biologicals is a rabbit polyclonal antibody to COMMD2. This antibody reacts with rat. The COMMD2 Antibody has been validated for the following applications: Western Blot. |
|---|
| Immunogen | Synthetic peptides corresponding to Commd2 (COMM domain containing 2) The peptide sequence was selected from the middle region of Commd2. Peptide sequence SSKLMISELDFQDSVFVLGFSEELNKLLLQLYLDNRKEIRTILNELAPRL. |
|---|
| Other Names | COMM domain containing 2, COMM domain-containing protein 2, HSPC042, MGC57611 |
|---|
| Gene, Accession # | COMMD2, Gene ID: 51122, Accession: D3ZLN7 |
|---|
| Catalog # | NBP1-68999-20ul |
|---|
| Price | |
|---|
| Order / More Info | COMMD2 Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|