| Edit |   |
| Antigenic Specificity | COMMD2 |
| Clone | polyclonal |
| Host Species | Rabbit |
| Reactive Species | rat |
| Isotype | n/a |
| Format | immunogen affinity purified |
| Size | 100 ul |
| Concentration | n/a |
| Applications | Western Blot |
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
| Description | The COMMD2 Antibody from Novus Biologicals is a rabbit polyclonal antibody to COMMD2. This antibody reacts with rat. The COMMD2 Antibody has been validated for the following applications: Western Blot. |
| Immunogen | Synthetic peptides corresponding to Commd2 (COMM domain containing 2) The peptide sequence was selected from the middle region of Commd2. Peptide sequence SSKLMISELDFQDSVFVLGFSEELNKLLLQLYLDNRKEIRTILNELAPRL. |
| Other Names | COMM domain containing 2, COMM domain-containing protein 2, HSPC042, MGC57611 |
| Gene, Accession # | COMMD2, Gene ID: 51122, Accession: D3ZLN7 |
| Catalog # | NBP1-68999 |
| Price | |
| Order / More Info | COMMD2 Antibody from NOVUS BIOLOGICALS, LLC |
| Product Specific References | n/a |