| Edit |   |
|---|
| Antigenic Specificity | COMMD8 |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | immunogen affinity purified |
|---|
| Size | 20ul |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blot |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The COMMD8 Antibody from Novus Biologicals is a rabbit polyclonal antibody to COMMD8. This antibody reacts with human. The COMMD8 Antibody has been validated for the following applications: Western Blot. |
|---|
| Immunogen | Synthetic peptide directed towards the middle region of human COMMD8The immunogen for this antibody is COMMD8. Peptide sequence IAALRMPLLSLHLDVKENGEVKPYSIEMSREELQNLIQSLEAANKVVLQL. |
|---|
| Other Names | COMM domain containing 8, COMM domain-containing protein 8, FLJ20502 |
|---|
| Gene, Accession # | COMMD8, Gene ID: 54951, Accession: NP_060315, SwissProt: NP_060315 |
|---|
| Catalog # | NBP1-79661-20ul |
|---|
| Price | |
|---|
| Order / More Info | COMMD8 Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|