| 产品详情 |
| Edit |   |
|---|
| Antigenic Specificity | Common beta Chain |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | affinity purified |
|---|
| Size | 100 ul |
|---|
| Concentration | n/a |
|---|
| Applications | Immunocytochemistry/Immunofluorescence. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100. |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The Common beta Chain Antibody from Novus Biologicals is a rabbit polyclonal antibody to Common beta Chain. This antibody reacts with human. The Common beta Chain Antibody has been validated for the following applications: Immunocytochemistry/Immunofluorescence. Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
|---|
| Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids: QQVGDYCFLPGLGPGPLSLRSKPSSPGPGPEIKNLDQAFQVKKPPGQAVPQVPVIQLFKALKQQDYLSLP |
|---|
| Other Names | beta, low-affinity, CD131, CD131 antigen, CDw131, colony stimulating factor 2 receptor, beta, low-affinity(granulocyte-macrophage), cytokine receptor common subunit beta, GM-CSF/IL-3/IL-5 receptor common beta subunit, GM-CSF/IL-3/IL-5 receptor common beta-chain, IL3RB, interleukin 3 receptor/granulocyte-macrophage colony stimulating factor 3receptor, beta (high affinity) |
|---|
| Gene, Accession # | CSF2RB, Gene ID: 1439 |
|---|
| Catalog # | NBP2-76540 |
|---|
| Price | |
|---|
| Order / More Info | Common beta Chain Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|
| 产品资料 |
|
|