| 产品详情 |
| Edit |   |
|---|
| Antigenic Specificity | p38 gamma/SAPK3 |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | immunogen affinity purified |
|---|
| Size | 0.1 ml |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin. For IHC-Paraffin, HIER pH 6 retrieval is recommended. |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The p38 gamma/SAPK3 Antibody from Novus Biologicals is a rabbit polyclonal antibody to p38 gamma/SAPK3. This antibody reacts with human. The p38 gamma/SAPK3 Antibody has been validated for the following applications: Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin. Specificity of human p38 gamma/SAPK3 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
|---|
| Immunogen | This antibody was developed against a recombinant protein corresponding to amino acids: FKGSDHLDQLKEIMKVTGTPPAEFVQRLQSDEAKNYMKGLPELEKKDFASILTNASPLAV |
|---|
| Other Names | EC 2.7.11, ERK3, ERK-6, ERK6MAPK 12, Extracellular signal-regulated kinase 6, MAP kinase 12, MAP kinase p38 gamma, mitogen-activated protein kinase 12, mitogen-activated protein kinase 3, Mitogen-activated protein kinase p38 gamma, P38GAMMA, PRKM12, SAPK-3, SAPK3EC 2.7.11.24, Stress-activated protein kinase 3 |
|---|
| Gene, Accession # | MAPK12, Gene ID: 6300, Accession: P53778, SwissProt: P53778 |
|---|
| Catalog # | NBP2-38729 |
|---|
| Price | |
|---|
| Order / More Info | p38 gamma/SAPK3 Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|
| 产品资料 |
|
|