| 产品详情 |
| Edit |   |
|---|
| Antigenic Specificity | PGD2 Synthase/PTGDS |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human, mouse |
|---|
| Isotype | n/a |
|---|
| Format | immunogen affinity purified |
|---|
| Size | 100 ul |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The PGD2 Synthase/PTGDS Antibody from Novus Biologicals is a rabbit polyclonal antibody to PGD2 Synthase/PTGDS. This antibody reacts with human, mouse. The PGD2 Synthase/PTGDS Antibody has been validated for the following applications: Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin. |
|---|
| Immunogen | Synthetic peptide directed towards the N terminal of human PTGDSThe immunogen for this antibody is PTGDS (NP_000945). Peptide sequence MATHHTLWMGLALLGVLGDLQAAPEAQVSVQPNFQQDKFLGRWFSAGLAS. |
|---|
| Other Names | Beta-trace protein, cerebrin-28, EC 5.3.99.2, Glutathione-independent PGD synthase, glutathione-independent PGD synthetase, lipocalin-type prostaglandin D synthase, Lipocalin-type prostaglandin-D synthase, L-PGDS, PDS, PGD2, PGD2 synthase, PGDS2, PGDSLPGDS, prostaglandin D synthase, prostaglandin D2 synthase (21kD, brain), prostaglandin D2 synthase 21kDa (brain), Prostaglandin-D2 synthase, prostaglandin-H2 D-isomerase |
|---|
| Gene, Accession # | PTGDS, Gene ID: 5730, Accession: P41222, SwissProt: P41222 |
|---|
| Catalog # | NBP1-79280 |
|---|
| Price | |
|---|
| Order / More Info | PGD2 Synthase/PTGDS Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | PubMed: 18448869, 25111383 |
|---|
| 产品资料 |
|
|