| 产品详情 |
| Edit |   |
|---|
| Antigenic Specificity | SOX2 |
|---|
| Clone | CL4716 |
|---|
| Host Species | Mouse |
|---|
| Reactive Species | human, mouse |
|---|
| Isotype | IgG1 |
|---|
| Format | Protein A purified |
|---|
| Size | 100 ul |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blot, Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin, Knockdown Validated. For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100. |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The SOX2 Antibody (CL4716) from Novus Biologicals is a mouse monoclonal antibody to SOX2. This antibody reacts with human, mouse. The SOX2 Antibody (CL4716) has been validated for the following applications: Western Blot, Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin, Knockdown Validated. Specificity of human, mouse SOX2 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
|---|
| Immunogen | This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:GSYSMMQDQLGYPQHPGLNAHGAAQMQPMHRYDVSALQYNSMTSSQTYMNGSPTYSMSYSQQGTPGMALGSM |
|---|
| Other Names | ANOP3, MCOPS3, MGC2413, SRY (sex determining region Y)-box 2, SRY-related HMG-box gene 2, transcription factor SOX2, transcription factor SOX-2 |
|---|
| Gene, Accession # | SOX2, Gene ID: 6657 |
|---|
| Catalog # | NBP2-59057 |
|---|
| Price | |
|---|
| Order / More Info | SOX2 Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|
| 产品资料 |
|
|