| Edit |   |
| Antigenic Specificity | KLF14 |
| Clone | polyclonal |
| Host Species | Rabbit |
| Reactive Species | human, dog, porcine, rabbit |
| Isotype | n/a |
| Format | affinity purified |
| Size | 50ug |
| Concentration | n/a |
| Applications | WB |
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
| Description | Rabbit Polyclonal Anti-KLF14 Antibody |
| Immunogen | The immunogen for anti-KLF14 antibody: synthetic peptide directed towards the N terminal of human KLF14. Synthetic peptide located within the following region: SAAVACLDYFAAECLVSMSAGAVVHRRPPDPEGAGGAAGSEVGAAHPESA |
| Other Names | BTEB5, Kruppel-like factor 14 |
| Gene, Accession # | KLF14, Accession: NM_138693 |
| Catalog # | TA341450 |
| Price | |
| Order / More Info | KLF14 Antibody from ORIGENE TECHNOLOGIES |
| Product Specific References | n/a |