| Edit |   |
|---|
| Antigenic Specificity | Klf2 |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | mouse, rat, porcine, human |
|---|
| Isotype | n/a |
|---|
| Format | affinity purified |
|---|
| Size | 50ug |
|---|
| Concentration | n/a |
|---|
| Applications | WB |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | Rabbit Polyclonal Anti-Klf2 Antibody |
|---|
| Immunogen | The immunogen for anti-Klf2 antibody: synthetic peptide corresponding to a region of Mouse. Synthetic peptide located within the following region: MALSEPILPSFATFASPCERGLQERWPRNEPEAGGTDEDLNNVLDFILSM |
|---|
| Other Names | LKLF, Kruppel-like factor 2 |
|---|
| Gene, Accession # | Klf2, Accession: NM_016270 |
|---|
| Catalog # | TA341787 |
|---|
| Price | |
|---|
| Order / More Info | Klf2 Antibody from ORIGENE TECHNOLOGIES |
|---|
| Product Specific References | n/a |
|---|