| Edit |   |
| Antigenic Specificity | ZNF195 |
| Clone | polyclonal |
| Host Species | Rabbit |
| Reactive Species | human |
| Isotype | n/a |
| Format | affinity purified |
| Size | 50ug |
| Concentration | n/a |
| Applications | WB |
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
| Description | Rabbit Polyclonal Anti-ZNF195 Antibody |
| Immunogen | The immunogen for anti-ZNF195 antibody: synthetic peptide directed towards the N terminal of human ZNF195. Synthetic peptide located within the following region: GLDNLYLRKDWESLDECKLQKDYNGLNQCSSTTHSKIFQYNKYVKIFDNF |
| Other Names | n/a |
| Gene, Accession # | ZN195, Accession: NM_001130520 |
| Catalog # | TA339446 |
| Price | |
| Order / More Info | ZNF195 Antibody from ORIGENE TECHNOLOGIES |
| Product Specific References | n/a |