| 产品详情 |
| Edit |   |
|---|
| Antigenic Specificity | RSK2 |
|---|
| Clone | 2G10 |
|---|
| Host Species | Mouse |
|---|
| Reactive Species | human |
|---|
| Isotype | IgG2b kappa |
|---|
| Format | IgG purified, no preservative |
|---|
| Size | 0.1 mg |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blot, ELISA, Immunocytochemistry/Immunofluorescence, Proximity Ligation Assay. Antibody reactivity against cell lysate and recombinant protein for WB. It has also been used for ELISA. |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The RSK2 Antibody (2G10) from Novus Biologicals is a mouse monoclonal antibody to RSK2. This antibody reacts with human. The RSK2 Antibody (2G10) has been validated for the following applications: Western Blot, ELISA, Immunocytochemistry/Immunofluorescence, Proximity Ligation Assay. |
|---|
| Immunogen | RPS6KA3 (NP_004577, 2 a.a. - 95 a.a.) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. PLAQLADPWQKMAVESPSDSAENGQQIMDEPMGEEEINPQTEEVSIKEIAITHHVKEGHEKADPSQFELLKVLGQGSFGKVFLVKKISGSDARQ |
|---|
| Other Names | 90 kDa ribosomal protein S6 kinase 3, CLS, Coffin-Lowry syndrome, EC 2.7.11, EC 2.7.11.1, HU-3, Insulin-stimulated protein kinase 1, ISPK1, ISPK-1, MAP kinase-activated protein kinase 1b, MAPK-activated protein kinase 1b, MAPKAP kinase 1b, MAPKAPK-1b, MAPKAPK1B, mental retardation, X-linked 19, MRX19, p90-RSK2, p90RSK3, pp90RSK2, ribosomal protein S6 kinase alpha-3, ribosomal protein S6 kinase, 90kD, polypeptide 3, ribosomal protein S6 kinase, 90kDa, polypeptide 3, Ribosomal S6 kinase 2, RSK, RSK-2, RSK2p90-RSK 3, S6K-alpha3, S6K-alpha-3 |
|---|
| Gene, Accession # | RPS6KA3, Gene ID: 6197, Accession: NP_004577, SwissProt: NP_004577 |
|---|
| Catalog # | H00006197-M01 |
|---|
| Price | |
|---|
| Order / More Info | RSK2 Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|
| 产品资料 |
|
|