| 产品详情 |
| Edit |   |
|---|
| Antigenic Specificity | RSK3 |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | immunogen affinity purified |
|---|
| Size | 20ul |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blot |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The RSK3 Antibody from Novus Biologicals is a rabbit polyclonal antibody to RSK3. This antibody reacts with human. The RSK3 Antibody has been validated for the following applications: Western Blot. |
|---|
| Immunogen | Synthetic peptides corresponding to RPS6KA2(ribosomal protein S6 kinase, 90kDa, polypeptide 2) The peptide sequence was selected from the middle region of RPS6KA2. Peptide sequence LSRQDVHLVKGAMAATYFALNRTPQAPRLEPVLSSNLAQRRGMKRLTSTR. |
|---|
| Other Names | EC 2.7.11, EC 2.7.11.1, HU-2, MAP kinase-activated protein kinase 1c, MAPK-activated protein kinase 1c, MAPKAP kinase 1c, MAPKAPK-1c, MAPKAPK1C, p90-RSK 2, p90RSK2, p90-RSK3, ribosomal protein S6 kinase alpha 2, ribosomal protein S6 kinase alpha-2, ribosomal protein S6 kinase, 90kD, polypeptide 2, ribosomal protein S6 kinase, 90kDa, polypeptide 2, Ribosomal S6 kinase 3,90 kDa ribosomal protein S6 kinase 2, RSK, RSK-3, RSK3pp90RSK3, S6K-alpha, S6K-alpha2, S6K-alpha-2 |
|---|
| Gene, Accession # | RPS6KA2, Gene ID: 6196, Accession: Q15349, SwissProt: Q15349 |
|---|
| Catalog # | NBP1-58352-20ul |
|---|
| Price | |
|---|
| Order / More Info | RSK3 Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|
| 产品资料 |
|
|