| Edit |   |
| Antigenic Specificity | Ceramide Kinase Like |
| Clone | polyclonal |
| Host Species | Rabbit |
| Reactive Species | human |
| Isotype | n/a |
| Format | immunogen affinity purified |
| Size | 20ul |
| Concentration | n/a |
| Applications | Western Blot |
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
| Description | The Ceramide Kinase Like Antibody from Novus Biologicals is a rabbit polyclonal antibody to Ceramide Kinase Like. This antibody reacts with human. The Ceramide Kinase Like Antibody has been validated for the following applications: Western Blot. |
| Immunogen | Synthetic peptides corresponding to CERKL (ceramide kinase-like) The peptide sequence was selected from the C terminal of CERKL. Peptide sequence ASVKNQFNFPFVETYTVEEVKVHPRNNTGGYNPEEEEDETASENCFPWNV. |
| Other Names | ceramide kinase-like, ceramide kinase-like protein, retinitis pigmentosa 26 (autosomal recessive), RP26 |
| Gene, Accession # | CERKL, Gene ID: 375298 |
| Catalog # | NBP1-68988-20ul |
| Price | |
| Order / More Info | Ceramide Kinase Like Antibody from NOVUS BIOLOGICALS, LLC |
| Product Specific References | n/a |