| 产品详情 |
| Edit |   |
| Antigenic Specificity | Aquaporin 1/AQP1 |
| Clone | polyclonal |
| Host Species | Rabbit |
| Reactive Species | human |
| Isotype | n/a |
| Format | immunogen affinity purified |
| Size | 0.1 ml |
| Concentration | n/a |
| Applications | Western Blot, Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin. For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF Fixation Permeabilization: Use PFA/Triton X-100. |
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
| Description | The Aquaporin 1/AQP1 Antibody from Novus Biologicals is a rabbit polyclonal antibody to Aquaporin 1/AQP1. This antibody reacts with human. The Aquaporin 1/AQP1 Antibody has been validated for the following applications: Western Blot, Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin. Specificity of human Aquaporin 1/AQP1 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
| Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids: PRSSDLTDRVKVWTSGQVEEYDLDADDINSRVEMKPK |
| Other Names | 28-kDa, AQP-1, AQP-CHIP, aquaporin 1 (channel-forming integral protein, 28kDa), aquaporin 1 (Colton blood group), Aquaporin-CHIP, CHIP2828kDa, CO blood group), CO, MGC26324 |
| Gene, Accession # | AQP1, Gene ID: 358 |
| Catalog # | NBP1-84488 |
| Price | |
| Order / More Info | Aquaporin 1/AQP1 Antibody from NOVUS BIOLOGICALS, LLC |
| Product Specific References | n/a |
| 产品资料 |
|
|