| 产品详情 |
| Edit |   |
|---|
| Antigenic Specificity | BRF2 |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | immunogen affinity purified |
|---|
| Size | 0.1 ml |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin. For IHC-Paraffin, HIER pH 6 retrieval is recommended. |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The BRF2 Antibody from Novus Biologicals is a rabbit polyclonal antibody to BRF2. This antibody reacts with human. The BRF2 Antibody has been validated for the following applications: Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin. Specificity of human BRF2 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
|---|
| Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids: VLTTTFSDEGNLREVTYSRSTGENEQVSRSQQRGLRRVRDLCRVLQLPPTFEDTAVAYYQQAYRHSGIRA |
|---|
| Other Names | B-related factor 2, BRF-2, BRF2, subunit of RNA polymerase III transcription initiation factor, BRF1-like, BRFUhTFIIIB50, FLJ11052, hBRFU, TFIIIB50RNA polymerase III transcription initiation factor BRFU, transcription factor IIB- related factor, TFIIIB50, transcription factor IIIB 50 kDa subunit |
|---|
| Gene, Accession # | BRF2, Gene ID: 55290 |
|---|
| Catalog # | NBP1-88355 |
|---|
| Price | |
|---|
| Order / More Info | BRF2 Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|
| 产品资料 |
|
|