| 产品详情 |
| Edit |   |
|---|
| Antigenic Specificity | BRIC |
|---|
| Clone | 3F10 |
|---|
| Host Species | Mouse |
|---|
| Reactive Species | human |
|---|
| Isotype | IgG1 kappa |
|---|
| Format | Protein A purified, no preservative |
|---|
| Size | 0.1 mg |
|---|
| Concentration | n/a |
|---|
| Applications | ELISA. This antibody is reactive against recombinant protein in ELISA. |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The BRIC Antibody (3F10) from Novus Biologicals is a mouse monoclonal antibody to BRIC. This antibody reacts with human. The BRIC Antibody (3F10) has been validated for the following applications: ELISA. |
|---|
| Immunogen | ATP8B1 (NP_005594.1 471 a.a. - 551 a.a.) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. INGQIYGDHRDASQHNHNKIEQVDFSWNTYADGKLAFYDHYLIEQIQSGKEPEVRQFFFLLAVCHTVMVDRTDGQLNYQAA |
|---|
| Other Names | ATPase class I type 8B member 1, ATPase, aminophospholipid transporter, class I, type 8B, member 1, ATPase, class I, type 8B, member 1, ATPICPFIC1, BRIC, EC 3.6.3, EC 3.6.3.1, Familial intrahepatic cholestasis type 1, FIC1phospholipid-transporting ATPase IC, PFICE1-E2 ATPase, probable phospholipid-transporting ATPase IC |
|---|
| Gene, Accession # | ATP8B1, Gene ID: 5205, Accession: NP_005594, SwissProt: NP_005594 |
|---|
| Catalog # | H00005205-M02 |
|---|
| Price | |
|---|
| Order / More Info | BRIC Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|
| 产品资料 |
|
|