| 产品详情 |
| Edit |   |
| Antigenic Specificity | BRM |
| Clone | polyclonal |
| Host Species | Rabbit |
| Reactive Species | human |
| Isotype | n/a |
| Format | immunogen affinity purified, no preservative |
| Size | 100 ul |
| Concentration | n/a |
| Applications | Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin |
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
| Description | The BRM Antibody from Novus Biologicals is a rabbit polyclonal antibody to BRM. This antibody reacts with human. The BRM Antibody has been validated for the following applications: Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin. |
| Immunogen | Synthetic peptide directed towards the middle region of human SMARCA2. Peptide sequence VINYKDSSGRQLSEVFIQLPSRKELPEYYELIRKPVDFKKIKERIRNHKY. |
| Other Names | ATP-dependent helicase SMARCA2, BAF190B, BRG1-associated factor 190B, BRMFLJ36757, EC 3.6.1, EC 3.6.4.-, global transcription activator homologous sequence, hBRMMGC74511, hSNF2a, probable global transcription activator SNF2L2, Protein brahma homolog, SNF2, SNF2/SWI2-like protein 2, SNF2A, SNF2-alpha, SNF2L2BAF190, SNF2LA, SNF2-like 2, Sth1p, subfamily a, member 2, sucrose nonfermenting 2-like protein 2, SWI/SNF related, matrix associated, actin dependent regulator of chromatin, SWI/SNF-related matrix-associated actin-dependent regulator of chromatin a2, SWI/SNF-related matrix-associated actin-dependent regulator of chromatinsubfamily A member 2, SWI2 |
| Gene, Accession # | SMARCA2, Gene ID: 6595 |
| Catalog # | NBP1-80042 |
| Price | |
| Order / More Info | BRM Antibody from NOVUS BIOLOGICALS, LLC |
| Product Specific References | n/a |
| 产品资料 |
|
|