| 产品详情 |
| Edit |   |
| Antigenic Specificity | CGI-09 |
| Clone | polyclonal |
| Host Species | Rabbit |
| Reactive Species | human |
| Isotype | n/a |
| Format | immunogen affinity purified |
| Size | 0.1 ml |
| Concentration | n/a |
| Applications | Western Blot, Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin. For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100. |
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
| Description | The CGI-09 Antibody from Novus Biologicals is a rabbit polyclonal antibody to CGI-09. This antibody reacts with human. The CGI-09 Antibody has been validated for the following applications: Western Blot, Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin. Specificity of human CGI-09 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
| Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids: KMIVMETCAGLVLGAMMERMGGFGSIIQLYPGGGPVRAATACFGFPKSFL SGLYEFPLNKVDSLLHGTFSAKMLSSEPKDSALVEESNGTLE |
| Other Names | CGI-09, GCD10, Gcd10p, KIAA1153, MGC5029, TRM6, tRNA (adenine-N(1)-)-methyltransferase non-catalytic subunit TRM6, tRNA methyltransferase 6 homolog (S. cerevisiae), tRNA(m1A58)-methyltransferase subunit TRM6, tRNA(m1A58)MTase subunit TRM6 |
| Gene, Accession # | TRMT6, Gene ID: 51605 |
| Catalog # | NBP2-13486 |
| Price | |
| Order / More Info | CGI-09 Antibody from NOVUS BIOLOGICALS, LLC |
| Product Specific References | n/a |
| 产品资料 |
|
|