| Edit |   |
|---|
| Antigenic Specificity | DUXA |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | immunogen affinity purified |
|---|
| Size | 20ul |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blot |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The DUXA Antibody from Novus Biologicals is a rabbit polyclonal antibody to DUXA. This antibody reacts with human. The DUXA Antibody has been validated for the following applications: Western Blot. |
|---|
| Immunogen | Synthetic peptide directed towards the middle region of human DUXA. Peptide sequence SRLLLQRKREPVASLEQEEQGKIPEGLQGAEDTQNGTNFTSDSHFSGART. |
|---|
| Other Names | double homeobox A, double homeobox protein A |
|---|
| Gene, Accession # | DUXA, Gene ID: 503835, Accession: NP_001012747, SwissProt: NP_001012747 |
|---|
| Catalog # | NBP1-91312-20ul |
|---|
| Price | |
|---|
| Order / More Info | DUXA Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|