| 产品详情 |
| Edit |   |
|---|
| Antigenic Specificity | RIAM/APBB1IP |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | rat |
|---|
| Isotype | n/a |
|---|
| Format | immunogen affinity purified |
|---|
| Size | 20ul |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blot |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The RIAM/APBB1IP Antibody from Novus Biologicals is a rabbit polyclonal antibody to RIAM/APBB1IP. This antibody reacts with rat. The RIAM/APBB1IP Antibody has been validated for the following applications: Western Blot. |
|---|
| Immunogen | Synthetic peptide directed towards the N terminal of human Apbb1ip (NP_001094047). Peptide sequence PPREEFNFSVGFKDLNESLNALEDQDLDALMADLVADISEAEQRTIQAQK. |
|---|
| Other Names | amyloid beta (A4) precursor protein-binding, family B, member 1 interactingprotein, amyloid beta A4 precursor protein-binding family B member 1-interacting protein, APBB1-interacting protein 1, INAG1, PREL1, PREL-1, proline rich EVH1 ligand 1, Proline-rich EVH1 ligand 1, Proline-rich protein 73, Rap1-GTP-interacting adapter molecule, Rap1-interacting adaptor molecule, RARP1, Retinoic acid-responsive proline-rich protein 1, RIAMRARP-1 |
|---|
| Gene, Accession # | APBB1IP, Gene ID: 54518, Accession: D3ZDZ1 |
|---|
| Catalog # | NBP1-91631-20ul |
|---|
| Price | |
|---|
| Order / More Info | RIAM/APBB1IP Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|
| 产品资料 |
|
|