| Edit |   |
| Antigenic Specificity | RIBC1 |
| Clone | polyclonal |
| Host Species | Rabbit |
| Reactive Species | human |
| Isotype | n/a |
| Format | immunogen affinity purified |
| Size | 100 ul |
| Concentration | n/a |
| Applications | Western Blot |
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
| Description | The RIBC1 Antibody from Novus Biologicals is a rabbit polyclonal antibody to RIBC1. This antibody reacts with human. The RIBC1 Antibody has been validated for the following applications: Western Blot. |
| Immunogen | Synthetic peptides corresponding to RIBC1 (RIB43A domain with coiled-coils 1) The peptide sequence was selected from the middle region of RIBC1)(50ug). Peptide sequence ANANKAQAAVQAGRQRCERQREQKANLAEIQHQSTSDLLTENPQVAQHPM. |
| Other Names | FLJ32783,2610028I09Rik, MGC46233, RIB43A domain with coiled-coils 1, RIB43A-like with coiled-coils protein 1 |
| Gene, Accession # | RIBC1, Gene ID: 158787, Accession: Q8N443, SwissProt: Q8N443 |
| Catalog # | NBP1-57751 |
| Price | |
| Order / More Info | RIBC1 Antibody from NOVUS BIOLOGICALS, LLC |
| Product Specific References | n/a |