| 产品详情 |
| Edit |   |
|---|
| Antigenic Specificity | SLC26A1 |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human, rat |
|---|
| Isotype | n/a |
|---|
| Format | immunogen affinity purified |
|---|
| Size | 0.1 ml |
|---|
| Concentration | n/a |
|---|
| Applications | Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin. For IHC-Paraffin, HIER pH 6 retrieval is recommended. Use in Immunocytochemistry/immunofluorescence reported in scientific literature (PMID 27210743). |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The SLC26A1 Antibody from Novus Biologicals is a rabbit polyclonal antibody to SLC26A1. This antibody reacts with human, rat. The SLC26A1 Antibody has been validated for the following applications: Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin. Specificity of human, rat SLC26A1 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
|---|
| Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids: DTAFYEDATEFEGLVPEPGVRVFRFGGPLYYANKDFFLRSLYSLTGLDAGCMAARRKEGGSETGVGEGGP |
|---|
| Other Names | EDM4, SAT1, SAT-1sulfate anion transporter 1, solute carrier family 26 (sulfate transporter), member 1, Solute carrier family 26 member 1, sulfate anion tranporter AT1, sulfate transporter, sulfate/anion transporter SAT-1 protein |
|---|
| Gene, Accession # | SLC26A1, Gene ID: 10861 |
|---|
| Catalog # | NBP1-84897 |
|---|
| Price | |
|---|
| Order / More Info | SLC26A1 Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | PubMed: 27210743 |
|---|
| 产品资料 |
|
|