| Edit |   |
| Antigenic Specificity | SLC26A10 |
| Clone | polyclonal |
| Host Species | Rabbit |
| Reactive Species | human |
| Isotype | n/a |
| Format | immunogen affinity purified, no preservative |
| Size | 20ul |
| Concentration | n/a |
| Applications | Western Blot |
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
| Description | The SLC26A10 Antibody from Novus Biologicals is a rabbit polyclonal antibody to SLC26A10. This antibody reacts with human. The SLC26A10 Antibody has been validated for the following applications: Western Blot. |
| Immunogen | Synthetic peptide directed towards the N terminal of human SLC26A10. Peptide sequence MRLDLASLMSAPKSLGSAFKSWRLDKAPSPQHTFPSTSIPGMAFALLASV. |
| Other Names | solute carrier family 26, member 10 |
| Gene, Accession # | SLC26A10, Gene ID: 65012, Accession: NP_597996, SwissProt: NP_597996 |
| Catalog # | NBP1-80393-20ul |
| Price | |
| Order / More Info | SLC26A10 Antibody from NOVUS BIOLOGICALS, LLC |
| Product Specific References | n/a |