| 产品详情 |
| Edit |   |
|---|
| Antigenic Specificity | CDK8 |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | affinity purified |
|---|
| Size | 100 ul |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blot, Immunocytochemistry/Immunofluorescence. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100. |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The CDK8 Antibody from Novus Biologicals is a rabbit polyclonal antibody to CDK8. This antibody reacts with human. The CDK8 Antibody has been validated for the following applications: Western Blot, Immunocytochemistry/Immunofluorescence. Specificity of human CDK8 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
|---|
| Immunogen | This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: LTEEEPDDKGDKKNQQQQQGNNHTNGTGHPGNQDSSHTQGPPLKKVRVVPPTTTSGGLIMTSDYQRSNPHAAYPNPGPSTSQPQSSMGYSATS |
|---|
| Other Names | CDK8 protein kinase, Cell division protein kinase 8, cyclin-dependent kinase 8, EC 2.7.11, EC 2.7.11.22, EC 2.7.11.23, K35, Mediator complex subunit CDK8, Mediator of RNA polymerase II transcription subunit CDK8, MGC126074, MGC126075, Protein kinase K35 |
|---|
| Gene, Accession # | CDK8, Gene ID: 1024 |
|---|
| Catalog # | NBP2-55134 |
|---|
| Price | |
|---|
| Order / More Info | CDK8 Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|
| 产品资料 |
|
|