| Edit |   |
|---|
| Antigenic Specificity | NUDT13 |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | immunogen affinity purified |
|---|
| Size | 20ul |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blot |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The NUDT13 Antibody from Novus Biologicals is a rabbit polyclonal antibody to NUDT13. This antibody reacts with human. The NUDT13 Antibody has been validated for the following applications: Western Blot. |
|---|
| Immunogen | Synthetic peptides corresponding to NUDT13(nudix (nucleoside diphosphate linked moiety X)-type motif 13) The peptide sequence was selected from the N terminal of NUDT13. Peptide sequence MSLYCGIACRRKFFWCYRLLSTYVTKTRYLFELKEDDDACKKAQQTGAFY. |
|---|
| Other Names | DKFZp586P2219, EC 3.-, nucleoside diphosphate-linked moiety X motif 13, nudix (nucleoside diphosphate linked moiety X)-type motif 13, Nudix motif 13, Protein KiSS-16 |
|---|
| Gene, Accession # | NUDT13, Gene ID: 25961, Accession: Q86X67, SwissProt: Q86X67 |
|---|
| Catalog # | NBP1-54929-20ul |
|---|
| Price | |
|---|
| Order / More Info | NUDT13 Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|