| 产品详情 |
| Edit |   |
|---|
| Antigenic Specificity | TUBGCP2 |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | immunogen affinity purified |
|---|
| Size | 0.1 ml |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blot, Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin. For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100. |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The TUBGCP2 Antibody from Novus Biologicals is a rabbit polyclonal antibody to TUBGCP2. This antibody reacts with human. The TUBGCP2 Antibody has been validated for the following applications: Western Blot, Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin. Specificity of human TUBGCP2 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
|---|
| Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids: PELLKVFSKLMSVCVMFTNCMQKFTQSMKLDGELGGQTLEHSTVLGLPAGAEERARKELARKHLAEHADTVQLVSGFEATINKFDKNFSAHL |
|---|
| Other Names | Gamma-ring complex protein 103 kDa, gamma-tubulin complex component 2, gamma-tubulin complex protein 2, GCP-2, GCP2hGrip103, h103p, hGCP2, hSpc97, MGC138162, SPBC97, Spc97p, Spindle pole body protein Spc97 homolog, tubulin, gamma complex associated protein 2 |
|---|
| Gene, Accession # | TUBGCP2, Gene ID: 10844 |
|---|
| Catalog # | NBP1-81841 |
|---|
| Price | |
|---|
| Order / More Info | TUBGCP2 Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|
| 产品资料 |
|
|