| 产品详情 |
| Edit |   |
|---|
| Antigenic Specificity | ZDHHC1 |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | immunogen affinity purified |
|---|
| Size | 0.1 ml |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blot, Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin, Immunohistochemistry-Frozen. For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100. |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The ZDHHC1 Antibody from Novus Biologicals is a rabbit polyclonal antibody to ZDHHC1. This antibody reacts with human. The ZDHHC1 Antibody has been validated for the following applications: Western Blot, Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin, Immunohistochemistry-Frozen. Specificity of human ZDHHC1 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
|---|
| Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids: HKLTTYEYIVQHRPPQEAKGVHRELESCPPKMRPIQEMEFYMRTFRHMRP EPPGQAGPAAVNAKHSRPASPDPTPGRRDCAGPPVQVEWD |
|---|
| Other Names | C16orf1, DHHC domain-containing cysteine-rich protein 1, DHHC-1, DHHC-domain-containing cysteine-rich protein, EC 2.3.1.-, HSU90653, probable palmitoyltransferase ZDHHC1, Zinc finger DHHC domain-containing protein 1, Zinc finger protein 377, zinc finger, DHHC domain containing 1, zinc finger, DHHC-type containing 1, ZNF377chromosome 16 open reading frame 1 |
|---|
| Gene, Accession # | ZDHHC1, Gene ID: 29800 |
|---|
| Catalog # | NBP2-13539 |
|---|
| Price | |
|---|
| Order / More Info | ZDHHC1 Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|
| 产品资料 |
|
|