| 产品详情 |
| Edit |   |
| Antigenic Specificity | ZDHHC13 |
| Clone | polyclonal |
| Host Species | Rabbit |
| Reactive Species | human |
| Isotype | n/a |
| Format | Protein A purified |
| Size | 20ul |
| Concentration | n/a |
| Applications | Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin |
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
| Description | The ZDHHC13 Antibody from Novus Biologicals is a rabbit polyclonal antibody to ZDHHC13. This antibody reacts with human. The ZDHHC13 Antibody has been validated for the following applications: Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin. |
| Immunogen | Synthetic peptides corresponding to ZDHHC13(zinc finger, DHHC-type containing 13) The peptide sequence was selected from the N terminal of ZDHHC13. Peptide sequence MVILLLQHGADPTLIDGEGFSSIHLAVLFQHMPIIAYLISKGQSVNMTDV. |
| Other Names | DHHC-13, EC 2.3.1, EC 2.3.1.-, FLJ10852, FLJ10941, HIP14LHIP14-related protein, HIP3RP, huntingtin interacting protein HIP3RP, Huntingtin-interacting protein 14-related protein, Huntingtin-interacting protein HIP3RP, MGC64994, palmitoyltransferase ZDHHC13, probable palmitoyltransferase ZDHHC13, Putative MAPK-activating protein PM03, Putative NF-kappa-B-activating protein 209, Zinc finger DHHC domain-containing protein 13, zinc finger, DHHC domain containing 13, zinc finger, DHHC-type containing 13 |
| Gene, Accession # | ZDHHC13, Gene ID: 54503, Accession: Q8IUH4-3, SwissProt: Q8IUH4-3 |
| Catalog # | NBP1-59026-20ul |
| Price | |
| Order / More Info | ZDHHC13 Antibody from NOVUS BIOLOGICALS, LLC |
| Product Specific References | n/a |
| 产品资料 |
|
|