| 产品详情 |
| Edit |   |
|---|
| Antigenic Specificity | PHLPP |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | immunogen affinity purified |
|---|
| Size | 0.1 ml |
|---|
| Concentration | n/a |
|---|
| Applications | Immunohistochemistry, Immunohistochemistry-Paraffin. For IHC-Paraffin, HIER pH 6 retrieval is recommended. |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The PHLPP Antibody from Novus Biologicals is a rabbit polyclonal antibody to PHLPP. This antibody reacts with human. The PHLPP Antibody has been validated for the following applications: Immunohistochemistry, Immunohistochemistry-Paraffin. Specificity of human PHLPP antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
|---|
| Immunogen | This antibody was developed against a recombinant protein corresponding to amino acids: SLDRKTLLLKHRQTLQLQPSDRDWVRHQLQRGCVHVFDRHMASTYLRPVLCTLDTTAGEVAARLLQLGHKGGGVVKVLGQ |
|---|
| Other Names | EC 3.1.3.16, hSCOP, KIAA0606, MGC161555, PH domain and leucine rich repeat protein phosphatase, PH domain and leucine rich repeat protein phosphatase 1, PH domain leucine-rich repeat-containing protein phosphatase 1, PHLPP, pleckstrin homology domain containing, family E (with leucine rich repeats)member 1, Pleckstrin homology domain-containing family E member 1, PLEKHE1, SCN circadian oscillatory protein, SCOPPH domain-containing family E member 1, Suprachiasmatic nucleus circadian oscillatory protein |
|---|
| Gene, Accession # | PHLPP1, Gene ID: 23239, Accession: O60346, SwissProt: O60346 |
|---|
| Catalog # | NBP2-33887 |
|---|
| Price | |
|---|
| Order / More Info | PHLPP Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|
| 产品资料 |
|
|