| 产品详情 |
| Edit |   |
|---|
| Antigenic Specificity | TRAP alpha |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human, mouse, rat |
|---|
| Isotype | n/a |
|---|
| Format | immunogen affinity purified |
|---|
| Size | 0.1 ml |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blot, Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin. For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF Fixation Permeabilization: Use PFA/Triton X-100. |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The TRAP alpha Antibody from Novus Biologicals is a rabbit polyclonal antibody to TRAP alpha. This antibody reacts with human, mouse, rat. The TRAP alpha Antibody has been validated for the following applications: Western Blot, Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin. Specificity of human TRAP alpha antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
|---|
| Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids: ESRKRKRPIQKVEMGTSSQNDVDMSWIPQETLNQINKASPRRLPRKRAQKRSVGSDE |
|---|
| Other Names | DKFZp781N23103, FLJ14232, FLJ22100, FLJ23034, FLJ78242, FLJ93042, signal sequence receptor, alpha, SSR alpha subunit, SSR-alpha, translocon-associated protein alpha subunit, translocon-associated protein subunit alpha, TRAP alpha, TRAP-alpha, TRAPASignal sequence receptor subunit alpha |
|---|
| Gene, Accession # | SSR1, Gene ID: 6745 |
|---|
| Catalog # | NBP1-86912 |
|---|
| Price | |
|---|
| Order / More Info | TRAP alpha Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | PubMed: 23435261, 24045953 |
|---|
| 产品资料 |
|
|