| 产品详情 |
| Edit |   |
| Antigenic Specificity | PDZRN3 |
| Clone | polyclonal |
| Host Species | Rabbit |
| Reactive Species | human |
| Isotype | n/a |
| Format | affinity purified |
| Size | 100 ul |
| Concentration | n/a |
| Applications | Immunocytochemistry/Immunofluorescence. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100. |
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
| Description | The PDZRN3 Antibody from Novus Biologicals is a rabbit polyclonal antibody to PDZRN3. This antibody reacts with human. The PDZRN3 Antibody has been validated for the following applications: Immunocytochemistry/Immunofluorescence. Specificity of human PDZRN3 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
| Immunogen | This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: SEQENNGDDATASSNPLAGQRKLTCSQDTLGSGDLPFSNESFISADCTDADYLGIPVDECERFR |
| Other Names | E3 ubiquitin-protein ligase PDZRN3, EC 6.3.2.-, Ligand of Numb protein X 3, likely ortholog of mouse semaF cytoplasmic domain associated protein 3, LNX3KIAA1095SEMACAP3, PDZ domain containing ring finger 3, PDZ domain-containing RING finger protein 3, Protein SEMACAP3, Semaphorin cytoplasmic domain-associated protein 3, SEMCAP3 |
| Gene, Accession # | PDZRN3, Gene ID: 23024 |
| Catalog # | NBP2-55802 |
| Price | |
| Order / More Info | PDZRN3 Antibody from NOVUS BIOLOGICALS, LLC |
| Product Specific References | PubMed: 29779941 |
| 产品资料 |
|
|